Bioinformatics - Module Project 3
Introduction
The purpose of this project is to help you gain familiarity with aspects of sequence homology, including DNA and protein alignments, the significance of using the appropriate scoring matrices and the using the BLAST search tool.[1]
Presented below are a sequence of exploratory steps you should undertake. Each of these steps is accompanied by a question. This is an individual project. Each of you will submit and be graded on the answer you provide for the question. Some of the questions are marked as General Questions. These are unrelated to the specific steps of the exercise and require independent research on your part.
Assignment
1. Basics: Download the myoglbin protein sequences from the pig, chicken and snake. Since these are full protein sequences, we will use the global sequence alignment method (the Needleman-Wunch). The matlab function to perform this alignment is nwalign. Here is an example of the usage of this function, sequence seq1 and seq2 are being aligned using PAM250 scoring matrix. The function returns the score and the alignment.
[score, align] = nwalign(seq1, seq2, ’scoringmatrix’, @pam250)
Perform the global alignments using PAM-10 and PAM-250 and complete similarity matrix shown in Fig. 1. Note that the similarly matrix is symmetric – so only upper half need be computed.
Complete the following matrix:
PAM - 10 PAM - 250
Pig Chicken Snake Pig Chicken Snake
Pig Chicken Snake |
Pig
Chicken Snake
2. The H and N Proteins:Next, we will look at the efficacy of flu vaccines. Influenza, commonly known as the flu, is caused by a virus that attacks the upper respiratory tract (i.e., the nose, the throat and the lungs). Cold and dry weather allows the virus to survive longer outside the body than in warm weather.
There are three types of influenza virus: A, B and C. Type A can infect humans, other mammals and birds and can spread fast. Types B and C affect only humans; and type C causes only a mild infection. Type A viruses are sub-typed based on proteins on the surface of the virus – specifically proteins hemagglutinin (abbreviated as H or HA) and neuraminidase (abbreviated as N or NA). Types A and B viruses continually evolve genetically with changes being made to the amino acid sequence of the H and N proteins and thus keep eluding the host’s immune system.
Each year, the influenza vaccine uses the prevalent strains from the previous years to design the vaccines. Generally, the vaccine contains three virus strains, two type A strains and one type B strain. Type C strain is not used since it only causes a mild infection. Each year in February, the World Health Organization (WHO) picks the three influenza virus strains to be included in the vaccine for that year. .
To find information on the strains in that season’s influenza vaccine, you will need to visit the Center for Disease Control http://www.cdc.gov/flu/weekly/fluactivitysurv.htm and look at ”Past Weekly Surveillance Reports” to select the previous influenza season. We will be investigating the 2009-10 influenza season. So, you will need to look at the 2008-09 influenza season summary and read the section titled “Composition of the 2009-2010 Influenza Vaccine.”
YOu will find that WHO recommended that the 2009–10 Northern Hemisphere influenza vaccine contain (1) A/Brisbane/59/2007-like (H1N1), (2) A/Brisbane/10/2007like (H3N2), and (3) B/Brisbane/60/2008-like (B/Victoria lineage) viruses.
Antigenic Characterization for 2009 - 2010: CDC antigenically characterized 2 seasonal influenza A (H1N1), 14 influenza A (H3N2), 43 influenza B, and 1,904 pandemic H1N1 viruses with 99.5% of pandemic H1N1 viruses being related to the A/California/07/2009 (H1N1) reference virus.
The 2 seasonal influenza A (H1N1) viruses tested were related to A/Brisbane/59/2007. The 14 influenza A (H3N2) viruses tested were related to A/Brisbane/10/2007, and were antigenically related to A/Perth/16/2009. Of the 43 influenza B viruses tested, 38 (88.4%) were related to B/Brisbane/60/2008. Five (11.6%) viruses tested belonged to the B/Yamagata lineage.
3. BLAST We’ve cloned a new mouse cDNA, and it has an open reading frame. We want to use BLAST https://blast.ncbi.nlm.nih.gov/ to characterize this mRNA.
MKRKFVGAAIGGALAVAGAPVALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGVLGL
STITNIILVAVGTATGARAEGSMGASREQESGPQDPPQELQEPQEPPSCKKQDLNLGKFVGAAIGGALAVA
GAPIALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGILGLSTSTNIILGAVGAATGA
TAAGAMGACREQEPGLQDLQQEPKEPQEPQELQKQQEPQEPQELQKQQETQETQETQELQKTQEPPSYEK
‡ Configure BLAST to run a search using all of the following parameters: NR database, using the blastp algorithm , with the filter on, and using =the matrix blosum62.
4. Dynamic Programming Grid: You are given five coding sequence fragments. These are thought to encode a homologous proteins in different species. The sequences begin with the start codon:
Answer the following:
References
[1] Chapter 5: Gautam B. Singh. Fundamentals of Bioinformatics and Computational Biology. Springer, 2015.
To export a reference to this article please select a referencing stye below.
Assignment Hippo (2022) . Retrive from https://assignmenthippo.com/sample-assignment/bioinformatics-module-project-3
"." Assignment Hippo ,2022, https://assignmenthippo.com/sample-assignment/bioinformatics-module-project-3
Assignment Hippo (2022) . Available from: https://assignmenthippo.com/sample-assignment/bioinformatics-module-project-3
[Accessed 15/08/2022].
Assignment Hippo . ''(Assignment Hippo,2022) https://assignmenthippo.com/sample-assignment/bioinformatics-module-project-3 accessed 15/08/2022.
Want to order fresh copy of the Sample Template Answers? online or do you need the old solutions for Sample Template, contact our customer support or talk to us to get the answers of it.
Our motto is deliver assignment on Time. Our Expert writers deliver quality assignments to the students.
Get reliable and unique assignments by using our 100% plagiarism-free.
Get connected 24*7 with our Live Chat support executives to receive instant solutions for your assignment.
Get Help with all the subjects like: Programming, Accounting, Finance, Engineering, Law and Marketing.
Get premium service at a pocket-friendly rate at AssignmentHippo
I was struggling so hard to complete my marketing assignment on brand development when I decided to finally reach to the experts of this portal. They certainly deliver perfect consistency and the desired format. The content prepared by the experts of this platform was simply amazing. I definitely owe my grades to them.
Get instant assignment help